PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc01127.1.g00010.1.sm.mkhc
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family HD-ZIP
Protein Properties Length: 718aa    MW: 77993.1 Da    PI: 5.0378
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc01127.1.g00010.1.sm.mkhcgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox62.37.4e-2097152156
                                     TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                        Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                                     +++ +++t +q++e+e++F+++++p+ ++r+eL+++lgL+  qVk+WFqN+R+++k
  Zpz_sc01127.1.g00010.1.sm.mkhc  97 KKRYHRHTLHQIQEMEAFFKECPHPDDKQRKELSRELGLEPLQVKFWFQNKRTQMK 152
                                     688899***********************************************998 PP

2START26.31.5e-09312385369
                                     HHHHHHHHHHHHHHC-TT-EEEE..EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCG CS
                           START   3 aeeaaqelvkkalaeepgWvkss..esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddk 69 
                                       +a++elv++a++++p+W       +++++e+ + f+ + +      ++ea+r+s+vv+m+   lve+l+d++
  Zpz_sc01127.1.g00010.1.sm.mkhc 312 VVAAMDELVQMAQLDAPLWGMGTigGQLDEEEYARMFPGGIGprqydLRSEASRDSAVVIMTRDSLVEILMDTM 385
                                     6789***************99888*************88888******************************98 PP

3START29.41.8e-1038541694124
                                     EEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EE CS
                           START  94 mvaelqalsplvp.RdfvfvRyirqlgagdwv 124
                                     m++e+q++splvp R+++fvRy++q ++g wv
  Zpz_sc01127.1.g00010.1.sm.mkhc 385 MSMEFQVPSPLVPtRESYFVRYCKQNPDGMWV 416
                                     89***************************998 PP

4START42.51.7e-14416458164206
                                     EEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
                           START 164 vtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                                     vtwvehv++++r++h+l+++lv+sgla+gak+wv tl+rqce+
  Zpz_sc01127.1.g00010.1.sm.mkhc 416 VTWVEHVEVDDRSVHNLYKPLVNSGLAFGAKRWVGTLDRQCER 458
                                     8****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.1E-2380152IPR009057Homeodomain-like
SuperFamilySSF466891.3E-1884152IPR009057Homeodomain-like
PROSITE profilePS5007116.45594154IPR001356Homeobox domain
SMARTSM003892.8E-1895158IPR001356Homeobox domain
CDDcd000861.71E-1897152No hitNo description
PfamPF000461.9E-1797152IPR001356Homeobox domain
PROSITE patternPS000270129152IPR017970Homeobox, conserved site
SuperFamilySSF559612.43E-13302460No hitNo description
SMARTSM002340.0027310458IPR002913START domain
PfamPF018527.8E-5312385IPR002913START domain
PROSITE profilePS5084812.082416461IPR002913START domain
PfamPF018528.1E-10416458IPR002913START domain
SuperFamilySSF559611.1E-24480708No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 718 aa     Download sequence    Send to blast
MTPGRMIGRN GVAYGSSSAM SLNQVDLLDS QHLQQAFQQH LFDQIPAPTL DSGDNMIHGH  60
ADTLVDEFES KSCSDNPDGT SGEDGQLEDP NQRPNKKKRY HRHTLHQIQE MEAFFKECPH  120
PDDKQRKELS RELGLEPLQV KFWFQNKRTQ MKASAITLDT LYYIALNQHE RQENAQLRAE  180
NDKLRSENMR YKEALSTASC PSCGGPAALG EMSFDEHHLR LENARLRDEI DRISGIAAKH  240
VGKPMVSFPL LPSPLAAAAA RSPLDLAGAY GVQPPSLTAD HIFGVGAGAG DLLRSVSTGH  300
LDADKPMIVE LVVAAMDELV QMAQLDAPLW GMGTIGGQLD EEEYARMFPG GIGPRQYDLR  360
SEASRDSAVV IMTRDSLVEI LMDTMSMEFQ VPSPLVPTRE SYFVRYCKQN PDGMWVTWVE  420
HVEVDDRSVH NLYKPLVNSG LAFGAKRWVG TLDRQCERLA SAMASNIPNG DLGVITSIEG  480
RKSMLKLAER MVTSFCGGVT ASAAHQWTTL SGSGAEDVRV MTRKSVDDPG RPPGIVLNAA  540
TSFWIPIPPK RVFDFLRDET SRSEWDILSN GGAVQEMAHI ANGRDHGNCV SLLRVNSANS  600
NQSNMLILQE SCTDASGSYV VYAPVDVVAM NVVLNGGDPD YVALLPSGFA ILPDGPPGAA  660
AEGESPGGGS LLTVAFQILV DSVPTAKLSL GSVATVNSLI ACTVERIKAA ICGEGNLQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004972697.10.0PREDICTED: homeobox-leucine zipper protein ROC1-like
SwissprotQ6ZAR00.0ROC1_ORYSJ; Homeobox-leucine zipper protein ROC1
TrEMBLK3YGB70.0K3YGB7_SETIT; Uncharacterized protein
STRINGSi013285m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP79938147
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G21750.20.0HD-ZIP family protein